PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g009490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 704aa    MW: 78803.3 Da    PI: 7.166
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g009490.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.3e-192580156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    rr+ +++t++q+++Le++F+++++p+  +r++L ++l+L+ +q+k+WFqN+R++ k
  Csa08g009490.1 25 RRNYHRHTNQQIQRLEAYFKECPHPDDLQRRQLGEELNLKPKQIKFWFQNKRTQAK 80
                    789999***********************************************988 PP

2START98.71.1e-312384584206
                     HHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.......EEEEE CS
           START   4 eeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla.......kaetl 82 
                     e+a +e++ +++  e++W+kss       +  n++++  k++  k+   ++e +++++vv  ++  lv  +ld+  +W + ++        + +l
  Csa08g009490.1 238 EKAVAEVMNLIQM-EELWKKSSiddrlviDPTNYEKCFAKISHFKGpsGRSESSKEVVVVQTDARILVDMFLDTE-KWARLFPtivneakNIRVL 330
                     5666666666665.689************************776669999***************9999999999.******9999977777777 PP

                     EEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--S CS
           START  83 evissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkg 174
                     +  ++g  +   +++ ++  lsplvp R+f ++R+++q+++ +w+i+dvS + ++    +s    ++++pSg lie+++ng skvtw+ehv++ +
  Csa08g009490.1 331 DSMDNGrqTLARVIYEQMHILSPLVPpREFIILRSCQQMEENVWMIADVSCNLPNVAF-ESMAPICTKHPSGVLIESLPNGCSKVTWIEHVEVTD 424
                     777888*999999**************************************9999988.5666678***************************88 PP

                     SX.XHHHHHHH.HHHHHHHHHHHHHHHTXXXXXX CS
           START 175 rl.phwllrsl.vksglaegaktwvatlqrqcek 206
                     ++ ph l+r l +  gl  ga++w+ tl++ ce+
  Csa08g009490.1 425 KTrPHRLYRDLfLYGGLGYGARRWTVTLEKMCER 458
                     8736*****97257789***************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-18882IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-19976IPR009057Homeodomain-like
PROSITE profilePS5007116.8442282IPR001356Homeobox domain
SMARTSM003892.7E-172486IPR001356Homeobox domain
CDDcd000864.30E-172583No hitNo description
PfamPF000461.7E-162580IPR001356Homeobox domain
PROSITE profilePS5084835.948226461IPR002913START domain
SuperFamilySSF559615.49E-27228458No hitNo description
CDDcd088751.30E-79230457No hitNo description
SMARTSM002345.4E-11235458IPR002913START domain
Gene3DG3DSA:3.30.530.201.2E-10237421IPR023393START-like domain
PfamPF018521.1E-25237458IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MDSSRDDSSS DERGNSTDTN NNQDRRNYHR HTNQQIQRLE AYFKECPHPD DLQRRQLGEE  60
LNLKPKQIKF WFQNKRTQAK SHNERESNAV LRAENMRMRR ENATMEDALK NVVCGPCGGR  120
GFGREEKQRN IQKLRAENAF LKSEFERFSN FLAQRGGHSM PSVGAFTYPH GPSTSNNRRA  180
SYGTSSNHLP QPSCSLRGPY ARGNISINQP HQLRKEMPLQ HFPPLSQMEK LVMFETAEKA  240
VAEVMNLIQM EELWKKSSID DRLVIDPTNY EKCFAKISHF KGPSGRSESS KEVVVVQTDA  300
RILVDMFLDT EKWARLFPTI VNEAKNIRVL DSMDNGRQTL ARVIYEQMHI LSPLVPPREF  360
IILRSCQQME ENVWMIADVS CNLPNVAFES MAPICTKHPS GVLIESLPNG CSKVTWIEHV  420
EVTDKTRPHR LYRDLFLYGG LGYGARRWTV TLEKMCERLY LSSISDFPNN DYAGVVQTIE  480
GRRSVMKLGE RMLKDFAWMI KMEKKLDFSQ QSETNSSGVT IAMRLNNEAG QPPGLILCAG  540
SSLCLPLPPP QWDVLCNGNP VTEVARFVTG TDKKNNVNFI ETSSGGDNNS NLMILQDGSI  600
DALGGMVVYA PMGLETAAIA SAGQVDPSTI PILPSGFIIS RDGRPSSAED PDGGSSTLLT  660
VAFQILVCDP NHSAAFNVEE SAATVNNVIS STVQRIKAML NCD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052382e-36AB005238.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKP11.
GenBankCP0026882e-36CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010420445.10.0PREDICTED: homeobox-leucine zipper protein HDG9-like
SwissprotQ9FFI00.0HDG9_ARATH; Homeobox-leucine zipper protein HDG9
TrEMBLR0H7P30.0R0H7P3_9BRAS; Uncharacterized protein
STRINGAT5G17320.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84681531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17320.10.0homeodomain GLABROUS 9